Home - Products - Others - Other Targets - (2E,4E)-hexa-2,4-dien-1-yl acetate

(2E,4E)-hexa-2,4-dien-1-yl acetate

CAS No. 57006-69-6

(2E,4E)-hexa-2,4-dien-1-yl acetate( —— )

Catalog No. M37379 CAS No. 57006-69-6

(2E,4E)-hexa-2,4-dien-1-yl acetate is an intermediate of the sex pheromone of the codling moth.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
2MG 296 Get Quote
5MG 459 Get Quote
10MG 657 Get Quote
25MG 994 Get Quote
50MG 1371 Get Quote
100MG 1773 Get Quote
500MG Get Quote Get Quote
1G Get Quote Get Quote

Biological Information

  • Product Name
    (2E,4E)-hexa-2,4-dien-1-yl acetate
  • Note
    Research use only, not for human use.
  • Brief Description
    (2E,4E)-hexa-2,4-dien-1-yl acetate is an intermediate of the sex pheromone of the codling moth.
  • Description
    (2E,4E)-hexa-2,4-dien-1-yl acetate is an intermediate of the sex pheromone of the codling moth.
  • In Vitro
    ——
  • In Vivo
    ——
  • Synonyms
    ——
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    Others
  • Research Area
    ——
  • Indication
    ——

Chemical Information

  • CAS Number
    57006-69-6
  • Formula Weight
    140.18
  • Molecular Formula
    C8H12O2
  • Purity
    >98% (HPLC)
  • Solubility
    ——
  • SMILES
    C(/C=C/C=C/C)OC(C)=O
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

molnova catalog
related products
  • Exendin-4 peptide de...

    FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.

  • Tylosin

    Tylosin (Fradizine; Tylocine; Tylosin A) is a broad spectrum antibiotic against Gram-positive organisms and a limited range of Gram-negative organisms.

  • 2,4-Difluorobenzalde...

    2,4-Difluorobenzaldehyde target bont - botulinum neurotoxin type A (Clostridium botulinum).